PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00185g00095.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 395aa    MW: 44594.5 Da    PI: 9.7375
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00185g00095.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.6e-32207260255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               pr+rWt+ LH+rF++ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Peaxi162Scf00185g00095.1 207 PRMRWTSSLHARFIHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 260
                               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15203260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-28205260IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23207260IPR006447Myb domain, plants
PfamPF002494.3E-7208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK SSSAWKRTNS TTDNEMNLLF WRRALESKNS ISKVPDNNTS  60
LFELSLSNPK PSPEPNSVNF HHLQNNHTNI IHSLYQNHLT NHYHQQQNKG LNSELSFLKP  120
IRGIPVYHQN PSTPTSPFPF TQQTFDNTTT AATLPLRSSA SYINNNNKLI SSTTMPFQSQ  180
QHHNHQAGIM RSRFLSRFPT KRTIRAPRMR WTSSLHARFI HAVELLGGHE RATPKSVLEL  240
MDVKDLTLAH VKSHLQMYRT VKTTDRAAGP ASSGQSEVFD NGSSGDNTSE DLMPDTENSR  300
KTELSNQQDR QRIHLPGKDY NGLWGNSSSR ESWQLHDKPG DYPGNIPSLE KKQHKDMEAN  360
CLSYDRVSAE VSSSSITETS PKKPNLEFTL GRSSE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-32HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615774.10.0PREDICTED: probable transcription factor KAN2 isoform X3
RefseqXP_016459616.10.0PREDICTED: probable transcription factor KAN2 isoform X3
SwissprotQ9C6167e-91KAN2_ARATH; Probable transcription factor KAN2
TrEMBLM1BE881e-162M1BE88_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000432001e-161(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-92G2-like family protein